
Recombinant 83-amino-acid IGF-1 analogue with Arg³ substitution and N-terminal extension, for in vitro research.
Purity
99%+
CAS Number
946870-92-4
Status
Made to Order
Dispatch
Same-Day (before 2pm)
Select Size
£199.99
Out of StockResearch verification required. All orders are reviewed before dispatch. You will receive an email confirmation and a WhatsApp or phone call within 60 minutes to verify your research purpose.
IGF-1 LR3 (Long Arg³ Insulin-like Growth Factor-1) is a synthetic 83-amino-acid peptide that's been engineered to work better than the natural IGF-1 your body produces. This lab-made peptide has two key modifications: an arginine substitution at position 3 and a 13-amino-acid extension at the N-terminal end. These changes make a big difference. They drastically reduce how much the peptide binds to IGF binding proteins, whilst extending its active half-life from just minutes to several hours. That's a game-changer for research applications. Studies have shown IGF-1 LR3 packs serious anabolic punch in cellular research. It's particularly good at ramping up protein synthesis and getting cells to multiply through the PI3K/Akt signalling pathway. Researchers have been exploring its potential in muscle tissue studies, wound healing research, and cellular regeneration work. Here's what's impressive: studies suggest IGF-1 LR3 is roughly 2.5 times more potent than natural IGF-1 when it comes to promoting myoblast proliferation. That's substantial. Our pharmaceutical-grade IGF-1 LR3 comes as a freeze-dried powder with over 98% purity—verified through HPLC analysis. We manufacture it under strict GMP conditions to ensure you get consistent results every time. Each vial contains precisely specified molecular weight suitable for advanced biotechnology research protocols. For in vitro laboratory research use only.
A simplified summary of what IGF-1 LR3 is studied for in research models. For laboratory in-vitro use only.
Sequence:Recombinant 83-aa analogue: N-terminal 13-aa extension + Arg³ substitution on human IGF-1
Origin: Engineered recombinant variant of insulin-like growth factor 1, designed to reduce binding affinity to IGF-binding proteins.
IGF-1 LR3 is studied as a high-affinity ligand of the type 1 IGF receptor. The Arg³ substitution is associated with reduced IGFBP-3 sequestration in vitro.
Research has examined receptor autophosphorylation and recruitment of IRS-1/IRS-2 adaptors. Downstream signalling cascades have been characterised in cultured myoblasts and fibroblasts.
Preclinical studies have explored IGF-1 LR3 in cell-culture proliferation assays and rodent skeletal muscle models. Not approved for human use.
For research use only. IGF-1 LR3 is not approved as a medicine in the UK and is not intended for human or veterinary administration. See the compliance page for full terms.
| Compound Name | IGF-1 LR3 |
| Category | Growth & Muscle |
| CAS Number | 946870-92-4 |
| Molecular Weight | 9117.6 g/mol |
| Molecular Formula | C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Purity | ≥99%+ (HPLC) |
| Form | Lyophilised powder |
| Storage | Store lyophilised at -20°C. Protect from light. Reconstituted: aliquot and store at -80°C. Use within 30 days of reconstitution. |
| Reconstitution | Reconstitute in sterile 0.6% acetic acid or bacteriostatic water (pH-adjusted). Typical stock concentration: 1 mg/mL. |
Every order of IGF-1 LR3 includes a batch-specific CoA with HPLC chromatogram, mass spectrometry data, and laboratory accreditation details.
A recombinant 83-amino-acid IGF-1 analogue investigated in preclinical research for its role in IGF-1 receptor signalling with reduced binding-protein affinity.
99%+, confirmed by independent third-party HPLC analysis. Batch-specific CoA included.
No. Supplied for in vitro laboratory research only. Not a licensed medicine.
IGF-1 LR3 is supplied by Premio Peptides (BELL RED LIMITED) exclusively for in vitro laboratory research. It is not a licensed medicine, is not approved for human or veterinary use, and must not be administered to any living organism outside a formally approved research protocol. Purchasers assume full responsibility for compliance with applicable regulations.